Backpacking Overnight (2-3 days)
TrekEasy3 days

Backpacking Overnight (2-3 days)

A 2-3 day backpacking trip into local wilderness builds self-sufficiency and trail confidence. Carry shelter, food, and water on your back through national forests, state parks, or wilderness areas. The skills you learn here — navigation, campcraft, weather reading — are the foundation for every bigger trek.

Be the first to train for this

Elevation Gain

800m

Best Seasons

Spring, Summer, Autumn

Region

Worldwide

trekkingbackpackingcampingwildernessself-supported

Community Resources

Videos

(0)

No videos yet. Know a great one?

Articles

(0)

No articles or guides yet. Know a helpful one?

Gear

(0)

No gear lists yet. Know a good one?

Prerequisites

Complete these adventures first to build the fitness, skills, and experience this adventure demands.

Day Hike Challenge / Peak Bagging

Peak bagging builds fitness and mountain awareness before adding overnight gear.

Demand Profile

Requirements Breakdown

Want to add Backpacking Overnight (2-3 days) to your plan?

Add it to your plan and we'll sequence it into a progressive multi-year roadmap based on difficulty.